Home Register Contact Us Statistics
   
 
 
Categories
Home Applications Games Movies Console Music TV Shows eBooks Graphics Other
 
Calendar
«    March 2010    »
MonTueWedThuFriSatSun
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
 
 
Archives
March 2010 (2609)
February 2010 (8508)
January 2010 (9187)
December 2009 (8187)
November 2009 (5617)
October 2009 (3284)
 
 
Applications : Windows XP With Vista Media Center DVD 2009
Author: creativelivenew 9 January 2010

Download 5x: Windows XP With Vista Media Center DVD 2009 . . . . . . . Download torrent: Windows XP With Vista Media Center DVD 2009


Windows XP With Vista Media Center DVD 2009


Windows XP With Vista Media Center DVD 2009

RELEASE INFO

Release Date ..... January 31, 2009

Program Type .... OS

Protection ......... Gates?

Platform ............ Windows XP Professional SP3 Corporate With Vista Media Center DVD

Language .......... English

Image Type ....... DVD ISO



INSTALL NOTES
1. Unrar and burn with Nero/UltraISO
2. License Product key intergated.

RELEASE NOTES:
Design base on Original Windows XP Professional with Service Pack 3
Windows XP Professional with Service Pack 3 - VL (x86) - CD (English)
Date Posted (UTC):5/2/2008 12:05:18 AM
Windows XP Professional with SP3 VL English
FILE: en_windows_xp_professional_with_service_pack_3_x86 _cd_vl_x14-73974.iso
Size: 589.14 MB
MD5: 5BF476E2FC445B8D06B3C2A6091FE3AA
SHA1: 66ac289ae27724c5ae17139227cbe78c01eefe40
ISO/CRC: FFFFFFFF

Warez Intergated
Windows XP Post-SP3 Update Pack version 1.0.3
Mediacenter vista sounds
Windows MediaPlayer11
Internet Explorer7
Sidebar
CPLBonus
Vista Drive
Uber Pack
Nlite\mp11 slipsteamer
KMPlayer with 11 skins (3 Vista)
Vista Codec Package 4.7.2
Setup billboard
Shell32 (avi's)
Oobe
System properties
Logon screen
Removed recyclebin from desktop

Drivers intergated:
Sata/Raid drivers intergated so supported newest Laptop/Desktop
+Intel ICH7R/M, ICH8R/M, ICH9R/M or ICH10R/D S-ATA AHCI and RAID Controllers
+nForce2/3/4 SataRAID and PataRAID systems

Intergated all hotfixs update to January 18, 2009

KB281981 - Disconnected sessions retain the original variable
KB887606 - Microsoft XML Parser (MSXML) uses cached credentials incorrectly
KB898461 - Permanent copy of the Package Installer for Windows version 6.3.13.0
KB909520 - Software update for Base Smart Card Cryptographic Service Provider
KB917275 - Windows Rights Management Services for Windows XP
KB922120 - Network Map in Windows Vista does not display computers that are running Windows XP
KB931125 - Microsoft Root Certificates Update (November 2008)
KB932578 - Event ID 55 may be logged in the System log when creating many files on an NTFS partition
KB932716 - Image Mastering API v2.0 (IMAPIv2.0) update
KB938759 - Cannot distribute or install a software package if the software package contains a very large signed file
KB940648 - "You might not have permission to use this network resource" error when trying to open My Documents folder after resuming from hibernation
KB942213 - The MMC.exe program randomly becomes unresponsive when the user clicks OK or Cancel several times to close a Windows form
KB942288 - Windows Installer 4.5
KB943232 - An application that uses Sxs.dll crashes when running the application
KB943729 - New Group Policy preferences in Windows Server 2008
KB944043 - Windows Server 2008 read-only domain controller compatibility pack
KB946648 - Security update for Windows Messenger 4.7
KB947460 - ": is not accessible" error when trying to open a mapped DFS folder after coming out of standby
KB948046 - A Word document is not printed as expected after installing the Windows European Union Expansion Font pack
KB948101 - USB keyboard does not work after restarting a computer that has an NVIDIA 680i motherboard
KB948720 - Cannot install device drivers in a Windows Server 2008 cluster environment if the drivers contain LZ-compressed files
KB949033 - Severe video degradation and a Stop error when connecting a USB Webcam to the computer
KB949127 - Cannot establish a wireless connection using EAP authentication if the Service Set Identifier (SSID) includes a comma
KB949764 - A USB device no longer works after resuming computer from hibernation (S4)
KB949900 - The RunOnce.exe process may stop responding during the driver installation process
KB950234 - " is not accessible. Access is denied" error when trying to open a shared file in Windows Explorer
KB950312 - "The application failed to initialize properly (0xC0000142)" error when trying to start a console-based application
KB950616 - An audio application that uses the Portcls.sys file may stop responding
KB950762 - Vulnerabilities in Pragmatic General Multicast (PGM) could allow denial of service
KB950974 - Vulnerability in Event System could allow remote code execution
KB951066 - Security update for Outlook Express
KB951126 - Multiprocessor computer stops responding on a black screen after resuming from hibernation
KB951163 - When trying to connect to the local computer using the MSTSC command, a black screen may appear for several minutes
KB951376 - Vulnerability in Bluetooth stack could allow remote code execution
KB951531 - The W32Time service does not synchronize the CMOS clock time to the Internet time after the W32Time service stops
KB951618 - A black screen occurs when upgrading the operating system on a computer that has Onekey Recovery 5.0 installed
KB951624 - A 30-second delay occurs during the initialization of some network-based applications
KB951698 - Vulnerabilities in DirectX could allow remote code execution
KB951709 - Event ID 26 when attaching two IDE ATA/ATAPI devices as master and subordinate IDE devices
KB951978 - Script output is not displayed as expected when running VBScript or JScript scripts
KB952069 - Security update for Windows Media Format Runtime and Media Foundation
KB952206 - Printer-driver upgrade fails on printer clients when multiple printer queues are upgraded at the same time
KB952954 - Vulnerabilities in Microsoft Windows Image Color Management could allow remote code execution
KB953024 - Rich Text Format (.rtf) files may not print correctly when using an application that uses the RichEdit control
KB953028 - An application experiences an access violation and then crashes if the computer has more than four cores or more than four logical processors
KB953155 - Vulnerability in Windows Internet Printing service could allow remote code execution
KB953609 - "At least one of your changes was not applied successfully to the wireless configuration" error when adding a wireless network
KB953761 - Some DHCP Options are not recognized when the DHCP server offer includes option 43
KB954193 - Jet 4.0 Database Engine cumulative hotfix package: July 2, 2008
KB954232 - On-Screen Keyboard behavior does not mimic the physical keyboard behavior in certain scenarios
KB954600 - Security update for Windows Media Player 6.4
KB954708 - Update to add support for the serialization of complex Extensible Metadata Platform (XMP) data types in the Windows Imaging Component
KB954879 - The LSASS.exe process crashes and the computer restarts when trying to start the Network Access Protection Agent service
KB954920 - Various error messages when an application requests a result set from new SQL Server 2008 collations
KB955043 - A memory leak may occur when running an application that uses the DHTML Edit control
KB955069 - Security update for XML Core Services 3.0
KB955109 - 0xC0000005 (Access Violation) error when running an application that uses the Application Desktop Toolbar (AppBar) component
KB955356 - When trying to start a computer that is connected to an IEEE1394 hard disk, it stops responding before the logon screen appears
KB955417 - Protected storage (PStore) uses a lower-quality cryptographic function when the system locale is set to French (France)
KB955567 - Data corruption may occur when trying to append data to a FILESTREAM varbinary (max) column in SQL Server 2008
KB955576 - TAPI-based applications stop responding, and you cannot disconnect telephone calls on a Windows XP-based telephony server
KB955832 - SSL connection may fail when using Internet Explorer to make an SSL connection to an HTTPS Web site that is certified by a DSS certificate
KB955839 - Cumulative time zone update (December, 2008)
KB955843 - An ADO-based application may stop responding when it uses the adAsyncExecute option to open a Recordset object
KB955988 - The Win32_Environment WMI class doesn't return the value of the PATH environment variable if it contains more than 1,024 characters
KB956072 - Terminal server does not allow RDP connections whose encryption level is set to Low
KB956391 - Cumulative security update for ActiveX (October, 2008)
KB956625 - Computer becomes unstable or crashes after running Internet Explorer 7 for a long time
KB956802 - Vulnerabilities in GDI could allow remote code execution
KB956807 - The Unicode hyphen character (U+2010) is not drawn when using an application that uses GDI+ API functions
KB956841 - Vulnerability in Virtual Address Descriptor manipulation could allow elevation of privilege
KB957263 - Changes to the custom properties of a program that supports custom properties may not be saved
KB958106 - Some components of an application not displayed correctly in a Terminal Services session
KB958149 - Performance decreases when streaming isochronous data on a computer that has a TI IEEE1394 host controller
KB958215 - Cumulative security update for Internet Explorer (December, 2008)
KB958244 - System may stop responding when restarting a multicore computer
KB958282 - 0x00000050 stop error when an application calls the NtGdiRectInRegion function
KB958347 - Device that is connected through a 1394 FireWire hub is still present in system after hot unplugging it
KB958644 - Vulnerability in Server service could allow remote code execution
KB958655 - "API call rejected - No actions in Context" error when installing multiple MSI packages
KB958687 - Vulnerabilities in SMB could allow remote code execution
KB958752 - Application compatibility issue with the version of AFD.sys that is released with MS08-037 and MS08-066 security updates
KB958817 - Automatic Update window may stop responding when using a WSUS server to deploy updates
KB959237 - Internet Explorer crashes when browsing a page that fetches and filters a recordset asynchronously from an instance of SQL Server
KB959267 - After repeatedly docking and undocking a portable computer, unable to change state of attached network device
KB959334 - Text that has the font set to Arial Black and the font style set to bold may change so that the font style is set to italic opening the document
KB959439 - After uploading encrypted files to a WebDAV share, the files remain encrypted
KB959465 - Write protection does not always work on SD memory cards
KB960071 - An access violation occurs when using an application that calls the SQLExecDirect function of the SQL Server ODBC driver to run a long query
KB960380 - A hyperlink control that is used to open a file or an e-mail message fails in an application that uses MSXML 6.0
KB960417 - When running an application that uses the SystemTimeToTzSpecificLocalTime function, performance is very poor
KB960680 - Update the Slovak koruna currency symbol (Sk) to the Euro (€) the Turkish currency symbol from Yeni Türk Lirasi (YTL) to Türk Lirasi (TL)
KB960714 - Security update for Internet Explorer

Other Updates
Adobe Flash Player 10.0.12.36 ActiveX Control
Code65536 FontReg 2.1.1
Microsoft European Union Expansion Font Update 1.2
Microsoft Qfecheck 6.2.29.0
Microsoft Update 7.2.6001.788
MSXML 4.0 SP2 (Includes KB954430 Hotfix)

Miscellaneous Tweaks
KB873374 - Microsoft GDI+ Detection Tool Registry Entry
KB890830 - Microsoft Malicious Software Removal Tool 2.6
Windows XP SP3 WBEM Fix ”




Download Links


Hotfile

http://hotfile.com/dl/23542008/5a27900/XP_Pro_SP3_With_Vista_Media_Center.part01.rar.html

http://hotfile.com/dl/23542011/aad8b96/XP_Pro_SP3_With_Vista_Media_Center.part02.rar.html

http://hotfile.com/dl/23542045/b8cc6e5/XP_Pro_SP3_With_Vista_Media_Center.part03.rar.html

http://hotfile.com/dl/23542144/0062cbf/XP_Pro_SP3_With_Vista_Media_Center.part04.rar.html

http://hotfile.com/dl/23542307/cd7e245/XP_Pro_SP3_With_Vista_Media_Center.part05.rar.html

http://hotfile.com/dl/23542312/05d9e3d/XP_Pro_SP3_With_Vista_Media_Center.part06.rar.html

http://hotfile.com/dl/23542318/5da5233/XP_Pro_SP3_With_Vista_Media_Center.part07.rar.html

http://hotfile.com/dl/23542464/820bc83/XP_Pro_SP3_With_Vista_Media_Center.part08.rar.html

http://hotfile.com/dl/23542473/1ab3924/XP_Pro_SP3_With_Vista_Media_Center.part09.rar.html

http://hotfile.com/dl/23542515/92852e7/XP_Pro_SP3_With_Vista_Media_Center.part10.rar.html


Uploading

http://uploading.com/files/f28d35eb/XP_Pro_SP3_With_Vista_Media_Center.part01.rar/

http://uploading.com/files/fm67f83m/XP_Pro_SP3_With_Vista_Media_Center.part02.rar/

http://uploading.com/files/e7m97b17/XP_Pro_SP3_With_Vista_Media_Center.part03.rar/

http://uploading.com/files/4ma94df3/XP_Pro_SP3_With_Vista_Media_Center.part04.rar/

http://uploading.com/files/7b45eed2/XP_Pro_SP3_With_Vista_Media_Center.part05.rar/

http://uploading.com/files/6f593m21/XP_Pro_SP3_With_Vista_Media_Center.part06.rar/

http://uploading.com/files/8389a482/XP_Pro_SP3_With_Vista_Media_Center.part07.rar/

http://uploading.com/files/7bmcc4f7/XP_Pro_SP3_With_Vista_Media_Center.part08.rar/

http://uploading.com/files/5bm5a6m9/XP_Pro_SP3_With_Vista_Media_Center.part09.rar/

http://uploading.com/files/a22be8bc/XP_Pro_SP3_With_Vista_Media_Center.part10.rar/



All links are interchangable. It mean you can download any part of archive from any server and can extract it without problem! PM me if links are dead, I will try to re-upload the file if I can!
 

Windows XP With Vista Media Center DVD 2009 Rapidshare


Bookmark and Share

Windows XP With Vista Media Center DVD 2009 rapidshare, megaupload, hotfile, netload. Windows XP With Vista Media Center DVD 2009 download free full. Windows XP With Vista Media Center DVD 2009 torrent download & keygen, crack, serial.

 
Related News:

  • Windows XP With Vista Media Center DVD 2009
  • Windows Dark XP Sp3 Edition v7 Rebirth Refix Version
  • Windows XP Vista Lite v3.2 with Hiren’s Boot v9.6


  •  (Votes #: 0)
    Comments (0)  
     
    Recent Searches
    - CorelDRAW Graphics Suite X3 | Sky High X Collection Vol 4 | Nova Era dj7 2009 | - Super DVD Creator 9.8 Multilingual | - Rapidshare Unlimited | Daybreakers 2009 R5 LiNE KvCD M1k3L | sex filme deutsch | merlin | Tweak-7 1.0 Build 1010 | The.Tournament.2009.DVDRip.XviD.MoH.part2 | smadav 7.6 antivirus | Cities XL crack 1 view | sex | zboardzboardphplivesetupincludesheader | vbulletin 3. | Inglorious Basterds (2009) DVDRiP iMBT | showroom mall | pensoftpayroll | LimeWire Basic 5.3.0 Beta (Freeware) | - Markus Schulz - Global DJ Broadcast: Ibiza Summer Sessions | four christmasies | zboardzboardphplivesetupincludesheader | Elven.Legacy-SKIDROW (RS) | movie up | my friends hot mom emma starr | Life On Mars UK 2006-2007 | free download WWE Smackdown vs. Raw 2010 PC game | advancedcommentsystemadmino...ssionloginappservmain | XP Ultimate Edition SP3 v8.1 Seven Style by Mad Dog | - ElectroBiT - System Addict | - Fetch 5.3 Mac | onone focal point 2 | alexander | Chuck Season 2 Episode 21 - HDTV | bbsskinhappycastvwarhappycastwrite | rat | - Stephanie Smith - Not Afraid (2008) | Babylon Pro 8.0.2 (r11) Full Package | - Insurgency: Modern Infantry Combat 2.1 RC2 Release (2008) | theme xpbbszboardbbsskinmyunboardskingalleryaskpassword | deutsch | contra vampire weekend | spotmau power suit | sex | creed full circle | vs2008 | Norton Internet Security 2010 TrialReset v2.5NE | erotik | Hi Res Tattoo Flash Mega Collection | pet society bet money hack |
    RapidShare Downloads | Free Movies RapidShare | Free Music RapidShare | Free Software Rapidshare | Free Games RapidShare | Free E-Books RapidShare
     
     
    Member
    Login:
    Password:
     
     
    Advertising.
     
    Partners
    Rapidshare Download RS Download Rapidshare Movies Sharing Centre
     
    Info
     
     
     
    Copyright 2009 RapidshareDownload.ORG All rights reserved.